PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P23010_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 303aa    MW: 31875.9 Da    PI: 10.5075
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P23010_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP121.59.7e-3853125274
                    TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasece 74 
                            a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLl qa+p+i+++tgt++++as+  
  GSMUA_Achr7P23010_001  53 APKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLHQAEPSIIAATGTGTIPASALA 125
                            789*****************************************************************97772 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.8E-3058127IPR005333Transcription factor, TCP
PROSITE profilePS5136927.31959113IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MDPKGSSKLH QEGLPQSDKR EPITSSSAAA AAAESRDLLL SAAAKDEQRR QLAPKRSSNK  60
DRHTKVDGRG RRIRMPALCA ARIFQLTREL GHKSDGETIQ WLLHQAEPSI IAATGTGTIP  120
ASALAAAAAA ASMPGWAVTG AANLGCSHPG LWPPLVGGFN SGFLHATATV PSSSNLSAGG  180
GDSVSSFMQR IGLHGFELTG GNPGAVSFAS MLSGHGQQLP GLELGLSQEG HIGALNPQAL  240
GQFYLQMGQG RGGVGAGGKI TSNVNYRINF TNASSIFFLW SQHVQKYQMH NKQWNHQGRC  300
RVP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009410644.11e-158PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD53e-64TCP20_ARATH; Transcription factor TCP20
TrEMBLM0TJY70.0M0TJY7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P23010_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.16e-60TCP family protein